PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG485100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 703aa    MW: 76663.4 Da    PI: 6.379
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG485100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.8e-211772156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Pavir.1NG485100.1.p 17 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 72
                         688999***********************************************998 PP

2START148.65.8e-472154402206
                          HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          +a +a++el+++a+a+e++W +       e +n d++ ++f++ ++       ++e +r+sg+v+m +  lv  ++d++ +W+e ++   
  Pavir.1NG485100.1.p 215 MATRAMDELIRMAQAGEQLWARTGgpdgrEVLNVDTYDSIFSKPGSsfrgpdVHVEGSRDSGLVFMSAIGLVDMFMDSS-KWTEFFPaiv 303
                          5789*******************9999999999999999997766699*******************************.********** PP

                          .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                            a t++v+ +g     + l+lm+ el ++sp+vp R+  f+Ry+rq + g w+i+dvSvd +          R+ +lpSg+li +++ng
  Pavir.1NG485100.1.p 304 sNARTIDVLVNGmagrsESLVLMYEELHVMSPVVPtRELCFLRYCRQIEHGLWAIADVSVDLQPRDARFGAPPRSCRLPSGCLIADMANG 393
                          *************************************************************7655554333457779************* PP

                          EEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh+++++r+p h l+r  + sg+a+ga +w+a+lqr ce+
  Pavir.1NG485100.1.p 394 YSKVTWVEHMEVEDRVPiHLLYRDRILSGAAFGAHRWLAALQRACER 440
                          *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-20674IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-221180IPR009057Homeodomain-like
PROSITE profilePS5007117.8151474IPR001356Homeobox domain
SMARTSM003891.6E-191578IPR001356Homeobox domain
CDDcd000861.23E-191675No hitNo description
PfamPF000462.0E-181772IPR001356Homeobox domain
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PROSITE profilePS5084843.152205443IPR002913START domain
SuperFamilySSF559611.69E-31206441No hitNo description
CDDcd088751.39E-106209439No hitNo description
SMARTSM002348.2E-37214440IPR002913START domain
PfamPF018523.5E-39215440IPR002913START domain
SuperFamilySSF559611.19E-19458694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MDFGDDVMDG SDGQHRKKRY HRHTPRQIQQ LEAMFKECPH PDENQRMQLS RELGLEPRQI  60
KFWFQNRRTQ MKAQHERQDN CFLRAENDKI RCENIAMREA LRNVICPTCG GPPVADDYFD  120
EQKLRMENAR LKEELDRVSS LTSKYLGRPF TQLPPVQPLS MSSSLELSVG GLGSLALGPS  180
LDLDLLSGGS SGYHHPAFHL PTAVPEMERP MMAEMATRAM DELIRMAQAG EQLWARTGGP  240
DGREVLNVDT YDSIFSKPGS SFRGPDVHVE GSRDSGLVFM SAIGLVDMFM DSSKWTEFFP  300
AIVSNARTID VLVNGMAGRS ESLVLMYEEL HVMSPVVPTR ELCFLRYCRQ IEHGLWAIAD  360
VSVDLQPRDA RFGAPPRSCR LPSGCLIADM ANGYSKVTWV EHMEVEDRVP IHLLYRDRIL  420
SGAAFGAHRW LAALQRACER CACLATAGMP PRDIAGVTPE GNRSMMKLSQ RMVSGFCASL  480
SASQLHRWTT LSGPNDVGVR VMVHRSTDPG QPSGVVLSAA TSIWLPVPCD RVFAFICDEN  540
TRSQWDVLSH GNPVQEVSRI PNGSHPGNCI SLLRGLNASQ NSMLILQESC TDASGSLVVY  600
APIDIPAANV VMSGEDPSAI PLLPSGFTIL PDGRAGAAPS SSSAAGPLGG SPPAGSLVTV  660
AFQILVSSLP SSKLNAESVA TVNSLISTTV EQIKAALNCA SH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK3YQE00.0K3YQE0_SETIT; Uncharacterized protein
STRINGSi016483m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52170.11e-178homeodomain GLABROUS 7